PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g10750.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 700aa    MW: 81366.5 Da    PI: 9.1189
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g10750.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR169.86.5e-2241128290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Yn+YA   GFs+r s+s++s  ++e+ k+ fvC+k  k++ + kk+ k+rr+++ + t+Cka+l vk++ d++w+v  +  +HnH+l 
  Bradi1g10750.2.p  41 HYNAYALVNGFSIRSSTSRRSLYTNEVEKQLFVCNKFRKPKVDGKKAPKQRRRETIKGTNCKARLIVKLM-DSRWQVVYFIAKHNHPLI 128
                       6*********************************************99**********************.9***************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.0E-2041128IPR004330FAR1 DNA binding domain
PfamPF105516.9E-34239333IPR018289MULE transposase domain
PROSITE profilePS509669.507521557IPR007527Zinc finger, SWIM-type
PfamPF044341.2E-4522556IPR007527Zinc finger, SWIM-type
SMARTSM005757.1E-4532559IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
TTTIPDNDNT DEQFPEDEVL SQPHEPYLGM RFDTLSCAKD HYNAYALVNG FSIRSSTSRR  60
SLYTNEVEKQ LFVCNKFRKP KVDGKKAPKQ RRRETIKGTN CKARLIVKLM DSRWQVVYFI  120
AKHNHPLITR PSLTKYLRSH QGIPKEEENF LRILHDSNLE TGRMMQLMSS FYGSSLLVPY  180
TTKAISNYRS RMRTQTHGGD MAETISYFTV LLDEEQRVQN LLWVDGAARK AYEDAYSDCI  240
SFDTTYLTNQ YNMPFASFIG INRHGQSFML GCGFLRDEKA TSFDWLFETY LDAMHGKAPQ  300
NIITDQDWAM RASIAKVFPN TVHRNCRWHI MKKAQEKLGS FLGRRPELVA QFNEVVDYSL  360
TPEEFEQSWA QMIAVHDVAS NKHIAWLYNI RATWVPCYFK DCFFPFLQST QHSEGFNAVL  420
KRYVNPHNSI LNFVQQYEKI HLKILVKEGG NDYRTDHVQV RPWSSYPIER QALNVYTRDI  480
YYRFREEFEK IGRYDVRQLA NDIYELYPNR KYCCEYGTRT YKVTARVEEA SYSCECCNFQ  540
KDGLLCCHIL KIFTHCSVDE ISQDYIIKRW KQQAIREEVA REEEKPDKVA REACGTDAGK  600
QMVEKHVRAM RTELSHLNKT RKTPKKAATT VPTAKTSTTA PTQPVDASAV RNPDRSATKG  660
KTRKRRFENA LELRPKRRNK CALCGSEDHN QATCLSKLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3GTY50.0A0A0Q3GTY5_BRADI; Uncharacterized protein
STRINGBRADI1G10750.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-92FAR1-related sequence 5